Total number of results for Erinaceus europaeus are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP03943 |
VPLEPVYPGDNATPEQMAHYAAELRRYINMLTRPRY
|
36 | Erinaceus europaeus | NPY | Pancreatic hormone | 8234904#Marks N.J., Shaw C., Halton D.W., Thim L.#The primary structure of pancreatic polypeptide from a primitive insectivorous mammal, the European hedgehog (Erinaceous europaeus).# Regul. Pept. 47:179-185(1993). |